SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074WQE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074WQE3
Domain Number 1 Region: 328-474
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-27
Family Regulator of G-protein signaling, RGS 0.00087
Further Details:      
 
Domain Number 2 Region: 199-300
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000194
Family DEP domain 0.023
Further Details:      
 
Domain Number 3 Region: 17-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000237
Family PadR-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074WQE3
Sequence length 491
Comment (tr|A0A074WQE3|A0A074WQE3_9PEZI) RGS-domain-containing protein {ECO:0000313|EMBL:KEQ75373.1} KW=Complete proteome; Reference proteome OX=1043004 OS=Aureobasidium namibiae CBS 147.97. GN=M436DRAFT_40838 OC=Aureobasidium.
Sequence
MHQTSSRLLRQTDDDRPFTRDLKDLFSTLMVSLPLTPHRVRFTKVEHTFTTDEALTNLGS
LKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEMARTVCNRFCEARFVESLDGKTDFSSRS
SVWQLTPKGMRVLTRFCQRNGIHQRHVNELLDSARNTMQLVILERVPENDNINIDRGTIE
VVFRRFCGEEGPNLKSTATADSESIHDYATGLVGVHMMRSRKQFEKDTPYMFTGKSALDW
LMDCCMVVNRKEACDIAQQFMVHQLIVNLTEERNSPAASRWSPLKTAHYGVTDKGMRIAG
WVRSPNGSINGEPVVVKLPPGVARDSNTTRMSQIIHDPAQRLVFREFLQETHCEENLTFY
LEVRSFLLDYNSAKRSVPAPRLDLIRETLASAYSLYNAFLAPGSPCELNIDHNLRNALAS
RMTRAVGEDTEMITSLDEVATLFDQAQTSVFKLMASDSVPKFSRDPKYIRMLENRTNYDQ
MNAAFSAASVS
Download sequence
Identical sequences A0A074WQE3
XP_013429415.1.85016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]