SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074WX24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074WX24
Domain Number 1 Region: 110-197,256-312
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.28e-18
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074WX24
Sequence length 503
Comment (tr|A0A074WX24|A0A074WX24_9PEZI) Putative 1,3-beta-glucan biosynthesis protein {ECO:0000313|EMBL:KEQ66921.1} KW=Complete proteome; Reference proteome OX=1043003 OS=Aureobasidium melanogenum CBS 110374. GN=M437DRAFT_63086 OC=Aureobasidium.
Sequence
MTSNDRHASPDMPYRTGAHTPLAQSRHAPLTSVATAAESRTDLNNPYAQDNDFMPANGRM
SPNGPYSPGLRSTMQRQSSSGNLEGVGQGEIQMQSFSEGLPPPPPVGHSWRRIDQWAEHN
HEELFENLCEGCTQNDVNELEHELDCTLPMEMRESLMIHDGQERGGRPTGILFGCMLLDC
EEIVQEWKQWARVGDDYLRASSAPFATPQIPNKAFAGSSTQPSAPQPASGAGWRSELMSK
QDSHPPNAVQKAYVHPGWIPVARDWGGNNICIDLAPGPAGKWGQVILAGRDYDCKYVVAR
SWSAFLASVADDLSTPKAVVDEETGELTLREFKNQNVDPSYMDILRWRTDQKYGRRMPKG
GRPQQPLRINSNVKNEFSSLNGFSPYASPTGSDRGRSPQRFSSNGKAPANQSPRGHVSSP
LARVAEETGPTLKTDNLDAVLDTSKSNDNLMSMDSPLPPTVETFADQDRKDEKEKADSAI
TSTEEATKGGASNDTEEMKTVEI
Download sequence
Identical sequences A0A074WX24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]