SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074WZT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074WZT8
Domain Number 1 Region: 144-247
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.15e-20
Family Flavin-binding PAS domain 0.00041
Further Details:      
 
Domain Number 2 Region: 10-123
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000191
Family Regulator of G-protein signaling, RGS 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074WZT8
Sequence length 472
Comment (tr|A0A074WZT8|A0A074WZT8_AURPU) Uncharacterized protein {ECO:0000313|EMBL:KEQ78653.1} KW=Complete proteome; Reference proteome OX=1043002 OS=Aureobasidium pullulans EXF-150. GN=M438DRAFT_329515 OC=Aureobasidium.
Sequence
MADFFAPDVFQAVLSDPATAIRLKSFCESTACDENIVFLEKIEQYSRLLTKARELLLDIH
ATYTSPNATEPVNISETISKDLNSAVNSATSVTFCAMQDIFTPARKDVEGLIRDDIYPRF
VTHQLTASAAMALAHDRKTYQGLGDCFCLTDPKVADNAILYASDGFLDVTGYSRREIIPR
NCRFLQGARTERSSVTRLKSAIDNGQENVQLLLNYRKDGTPFWNLLYVAPLRDEAGNIAF
FLGGQIDCSTTVHGKPDVMRILKLDGRRSFESTRGNLAVEDTSNLTATSPREHMKRHRSM
FKSTSSVTTQVRQGPGMENDLIGRLGNMKLETQMQMFQTAYSKYVVLKMKDRTGLSIAHY
SSSAGDLLRSSRTHGTSERIVNEDIFKLLAERSPSSSSVMKSYKKTVTDLLAEGKAVSVD
IELVVEEKARNLMPTGPGGKTEERLISHWTPCKDEEGRTKYVVLVLAERRDL
Download sequence
Identical sequences A0A074WZT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]