SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074XTS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074XTS2
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Bromodomain 5.89e-24
Family Bromodomain 0.0007
Further Details:      
 
Domain Number 2 Region: 114-204
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-23
Family Bromodomain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074XTS2
Sequence length 205
Comment (tr|A0A074XTS2|A0A074XTS2_AURPU) Bromodomain-containing protein {ECO:0000313|EMBL:KEQ85367.1} KW=Complete proteome; Reference proteome OX=1043002 OS=Aureobasidium pullulans EXF-150. GN=M438DRAFT_249829 OC=Aureobasidium.
Sequence
GPFLRPVDEVRDNAPGYYARIRQPMDLATMRTKLEGGRYNAAADFKADFDLMISNCYEYN
TAGPASLTDLAERFVKDFDWEWEQMARWRSKERSRLLKLQQPPPAPSAIAQSSVSSGSNV
SMKEAELLFCQHILQEFIRPKHKRYVPFFKEPVDAARVPSYHTIIKKPIDLATITTKLEN
QQYDSAATFKADFDLMFNNSDHFNA
Download sequence
Identical sequences A0A074XTS2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]