SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074XU87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074XU87
Domain Number 1 Region: 60-132
Classification Level Classification E-value
Superfamily Chromo domain-like 2.75e-16
Family Chromo domain 0.0022
Further Details:      
 
Domain Number 2 Region: 181-242
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000698
Family Chromo domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074XU87
Sequence length 249
Comment (tr|A0A074XU87|A0A074XU87_AURPU) Uncharacterized protein {ECO:0000313|EMBL:KEQ87179.1} KW=Complete proteome; Reference proteome OX=1043002 OS=Aureobasidium pullulans EXF-150. GN=M438DRAFT_403722 OC=Aureobasidium.
Sequence
MPPAISDDERSSPFSADDDVLPPKKPAPKKSAAKSKAKPAQEDAIDGEPMTDIKNGDAEA
QDDEDEDNSDEYVVEKILSHAPGQGKTTLYEVKWMGYENPDDRTWEPEENLEGAMDILQA
YWDSIGGKPQPKTPAKKGTKRKSTAATSQDTPEVSSSSTKRRGRKAPKTEEAAEEKTATL
PEGSWEHHVQSVDAIEMSEEGEHKGNLMIYLLWNNGSRTQHTALQCRSKCPNKLLDYYES
KLVFKNTDE
Download sequence
Identical sequences A0A074XU87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]