SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074Z9C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074Z9C1
Domain Number 1 Region: 973-1109
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-37
Family Regulator of G-protein signaling, RGS 0.0000517
Further Details:      
 
Domain Number 2 Region: 564-666
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-25
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 803-832
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000196
Family Transducin (heterotrimeric G protein), gamma chain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074Z9C1
Sequence length 1141
Comment (tr|A0A074Z9C1|A0A074Z9C1_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER23688.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_08494 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MRNDISLLGSDPVVMQTILNNLTTSALVWHALHTCKVLSAAARLGRIEPNADEPTEAVEK
FVCLGSCISPGLAKADISIRVGEAIGAIVNSRHRWCGRDTSLSVNGRVYNAAMRPISLYV
SQTWPLRANDVKRHSVSDHRYLRIIARVCRREETEPYRGVMVCAPQGPIELHWEIPPRHS
ESLIPGLALRTDDYVRLASILRAASARHMALTSSDISKSVFEPRHPACLAALNVRTLNQS
GQVALALALNSLGFDVRCVSETRIQDTSTVIELTAPSVFTRFRLRTSDDPEAAAVGCAGV
VIVLSHQREVKVCVRADREVWWTQKAKEMEGVQKTGNSRRLFQLIRARGPRKPPVSETTK
HRNGRTISNKEERLDRWAQYFEQQLSWPPAGTHLEPPRGLAICSLKLHRASGPDGLPPAL
FKDGSEVLSQRSSDLFACTWEKESVTQLVCPLSPFIFSFADDIVLIFDEEEKAQVFLDEL
TKSRPALWTSGPLCPASECGSFPRRNPSSSSSSKSPEEKQSVNSKSSSAKISLSVGQLDV
SDRCKQGKQAVCEGGVSSSSRNSPNDYIWQKIESLIEKMVSDENGIPVRNVKSLMSTIPS
TFTGSDIVQWLMQHVGASDVAEAVNLGSRIASMGYIFCIDDHTLTVKNDNHTYYRFQTPF
LYPSRCMEADTVDYAVYLCKRTMQNKQRLELTGFEAERLASLQNLYCHRWEFVYIQAEAE
AKVDKKRDKLERLVLDSQERAYWDVHRPPPGCVNTTDIDMRKLCRAKRPKKIPCRPVNFP
IPSGPVLEGIPLQDAVAKLNAAFRTRIKTTKAAESLQNYCDQYSEFDLLLSASALTPSTA
TVGQPSATASATQLFAAGPNRAASPHSNTIAGRSASDKGIGGGRIGASGFVGFVSSGSTN
FLRTVGSSNNTAGHSVATGTSLGGSGGGTTHGSLGHMIGTSQNLSHETVHESASALNPWI
SDNPDHWNTDARPKYLPIRRVKRWSFSIHELLKDPIGLEEFQRWLEKEFSAENLRFWQAC
QELKGAPLRELRQRVLNIYNQYLAPNAVDPLNVDSRIADSIRRQLSNTSPDVNLDRYCFE
EAESHIFHLMKSDSYYRFLRSDYYRELFSGVKKKSKKHRSGVGLAGGAIGVQAAGVGVGL
D
Download sequence
Identical sequences A0A074Z9C1
XP_009172572.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]