SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZAR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZAR7
Domain Number 1 Region: 64-227
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-27
Family Regulator of G-protein signaling, RGS 0.0000991
Further Details:      
 
Domain Number 2 Region: 1114-1194
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-24
Family DIX domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074ZAR7
Sequence length 1195
Comment (tr|A0A074ZAR7|A0A074ZAR7_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER24401.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_07915 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MSYPPEASRSCHEADGRSDRSGGSGGAAGSTSSGGVYGPLCGTSGKWPFSTSSIDPPVAN
DRLLSNWKKWSLGLDYLLQDSEGVALFKSYLQYEGCSNLLDFWFACQGFRSKVDPSDHRK
ISQLIKAIYRTYIRGSSSGNVGFTTAPITTMLTEPQVLIQPRTEPIRLRTETRRMIAERI
SRKHALDQTVFDPAQAEVEQFLRTTAYPAFLKSDVYVDFLQSTLEGSNRRFQLSQPGTSW
SSCLVDSASGHSVHGLPEGPTNFPLSGKILPTLEEDRELNSEELSGHVGLSHLRPASSSC
PPNPAGDSMHLSSAQSPPWHCPHCSQYHSQGHQTPCTASDPVQRTNYPPPHLFPPGFRPP
FSVPMTTNAVVCSAPLTVENLQMTRFYRAELSLQQHTFSNHPTRSQQQQQQQHPAPQPAS
MPASFGPLRPALSPPPALIQPQDSGDANRPRNAYYYYRGCDQKPGAFPRAHLNYMYTHWA
DAVCPLPTQASDPRSGNRLPSQPPNPYHISYAPVSARDSERHSLSSEARTDDTHSHTDSS
HDGGGTRLWHSFGHRHPASHSYHQSDRHTQPHHPPPPQQQQHHNQSTTAPQPSALAPPSL
RGQSADYPHLAECSECVCTHHRATVTSLSSPVPFVTSPRPAFPTREDLGHSQRLTGLDTA
TGTSMTQSQVGQRMQPVQSTDHQPGRSHAKHQRRAVRRGVTGWRSGDRSKSAAAPAVGDA
LPEPVTSKTTVSRSHNLAERDPQAFFRLLSEKLQHVLDNQLATERLDRIMTDTSPVPPHS
TGDQTTDFPPTAGKQPDPIEDITVASSAGMTVSTTAAPEVAVPTTVPDARQSGLAVSSLL
QRPWADRLLAAARIHENTRDNAQAILEDHCSRIWAASADRTPTSSGSGSGGAGGGGEVGV
LGSAGTNTLMTETDNAVRLYELGCRSLDPAFHLKTHQPIIHVKQNEAEDDPRSLHSPHSR
SSSRCSDVVGNPLQSTRSRHHALLPSGKEEGEMWPGDSMAATPGVQPAAPLEQQPGKECI
VDSQPVPDSPSSCMSSYVESSASPGLLPTTLPCGRLSNMESSVRSVGLQVAASPVPPCIT
TPHSVSSSSTTTSVVSVSTPGLPVSSPSSGSPHSLVIGYYLGDDPVPYRSLWPSAEITLG
QFKQLIPKKKGSFRYFFKKLSNEFGSGVVHQEITNDSCLLPLWEGKVVAKVERIE
Download sequence
Identical sequences A0A074ZAR7
XP_009171839.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]