SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZB50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZB50
Domain Number 1 Region: 335-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-83
Family Protein kinases, catalytic subunit 0.0000000000313
Further Details:      
 
Domain Number 2 Region: 206-331
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.57e-26
Family Regulator of G-protein signaling, RGS 0.0000141
Further Details:      
 
Domain Number 3 Region: 747-869
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000144
Family Pleckstrin-homology domain (PH domain) 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074ZB50
Sequence length 993
Comment (tr|A0A074ZB50|A0A074ZB50_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER22787.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_09192 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MKELDIRRRKLASRKQMLLSCDCFDEENSICGDCELGFPSSEPKAERFVAKFNSEETERT
NLSTNRPRKGDAAGTRTAAREMDAKRVDHYTTTPGFGLPKIEIDKFSGNPIEFWKSMKAF
EMSVADRLLDDSNKLINHTMADLEAVLADVSYLMAMEMSKSTPAARASKRIALPDPSDAG
SRTDDSVATPFVVSSLLTNLCDHPLPQGYLLFREFALNCSEEAVPQFGFYEDIKKFEKLE
TDEERIKLGKEIYDQYIMRELLSQTHKFPKSILDSVLELLTQAQKTNSLPADTFSPYIDE
LLPVLRGEVFDNFLRSNKFTRFCQWKNLELNINLTTNDFSVHRIIGRGGFGEVYGCRKAD
TGKMYAMKCLDKKRIKMKGGETLALNERIMLSLVSTGDGCPFIVCMTYAFQTPEKLCFIL
DLMNGGDLHYHLTQHNIFSESEVRFYAAEVILGLEHMHNRFVVYRDLKPANILLDEYGHV
RISDLGLACDFSRRKPHASVGTHGYMAPEVLQKGCPYDSSADWFSLGCMLYKLLRGHSPF
RQHKTKDKHEIDRMTMTMNLDFPDSMSKEMRHLLEGLLAREVNHRLGCMGRGSMELREHP
FFKGVDWQQVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTETDQALYQNFSL
VVSERWQLEIAETVFDVVNQEADKMDAKRARARQRSNQIADEIGQATCITSTPTGGSSQQ
TMVGGSCNISASTPPTMGGDGLTQDGFASDCIVEGEVLKLGGPFLQTWQRRHLRLFPNRL
ELYNKSRDGLVLKKGVELISMLDIKEIAPEFSRVCKMDNCICIKLKNDNRVYITSNDKVL
ITQWKEEILDGYRLSCEIMSHMNRKAHKMYGVLDPVVNADGNAGGDAGSSNTLPSLTNTS
SNRTILPFNSSKASPKSHSPPHSGSSSGRPRLNHQASMPTYPVSSSTSQQVPPAASLNPK
GSDQSPHTLGSCTLPTRPTTRATPSDTAEPADE
Download sequence
Identical sequences A0A074ZB50
XP_009173468.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]