SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZIE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZIE3
Domain Number 1 Region: 51-504
Classification Level Classification E-value
Superfamily Sema domain 1.96e-50
Family Sema domain 0.00023
Further Details:      
 
Domain Number 2 Region: 719-790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 877-930
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 502-541
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000209
Family Plexin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074ZIE3
Sequence length 1327
Comment (tr|A0A074ZIE3|A0A074ZIE3_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER26746.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_13935 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MLQPFIATIAVLLGFCYQNAVSQLDRSVPSYRIVHIDDLVSNPTTGKEHKRFGSIEDDSE
FTQFAVHFERDSIFLGSNKSVLRLSLDEFHKVDQVIWSLSQKYGESCSSVNGSKIGCQFS
SVSLLVPLDDVFFTANSKAFRSGLYACLTDGTSSECTLRQAADLRGPPKTHWKDLAHRPV
TDYSQVVGLVTSNRYLYVATRFGNNSGSKNVIMRIAAESETSLKASGPKMIETPVGSNWI
MQDERTVFVGAFEFHNAVYFIFRETAHEALESCQSQSDNGGPRKKLESFTKATLVCPSEN
NADGESTAFIFNEVQSVQVDQGTKTLFAAFTTSSSIPPGSVVCAYRLTDIEDAFRGPLHL
ANGQATKFESSGDCTRPNMNVFSAHRLMYRVIKPRQGYAILRKDGVRWSRLVVDWAPHTP
KTDNNLVLFTMDTKGILSKWHVFKGESCLIEQIHFQLRSKPMDALHIVGMAIWPANKNSK
SSSSGALIVVTKSDVFRLPVSRCGLVGHLREICETIQDPYCGWNMQTERCEGLTTRTEHT
KHVIRFDICAPDLKKDPKFSIDGQWGAWSAWSACSMSGLTGEKEGWISEHRNSQQAQAVA
RSLELHGCQCRYRLCSAPYPFGQQGKKCMEGPAAQTTNCSISGGWTSWSSWSGCEPACRP
AGTSALQEDIFVPARTRQRWCLNPAPLGPQGEQCVGAGKESQPCIGPLPMCPEQNLPTPS
WSQWSEWSDCSTSCNGGRRIRWRQCGREEMKSAPPKLDKSTYKKIIRASLDKTLCLGEAF
EEQECNTQPCPVNKVTSAWTTWYVAEGDKAAGTLERCYRVECVANVPEVDKLHATMQVQN
GECEIDANGVLVCQEPTTGSAKETVGSESWLEANLENRWSVWTVCSRPCGGGTRFRWRPR
KTKGTTTTKGKQSQNSEVDKQEEACNTHSCPGHWSCWTQWSACTEPPCSENRGEQRRYRS
CLIPSSLTLPFGESPDINLCSGGEEHSVQSRPCEVTVEDVQCRNTAVNVMLKSKRMMPLD
GNTSESTSAYNRKADVTPWAAWSDCFRPSGLDYDVRVRAREKCLDCEVVQAKRCDSDQFV
PVAEILAADNTIHSPGQKSAQPVKNYTLTHAIVVAVFGALLGVTVVLVPYLIYTMTERKQ
REHRDRADRSQLWQKLVKDKYHSDRSLPYIWVGETDEDGKGNRKRFSKKRIPSHSETITK
TRSKWNPVESGGMSDTLQNQAALSRRPFPHASLTRIQALHNDHRTRPPIEIPSEEEHRRD
TGPENGHDGISLFPNYESASPRVQTGTSNGTKPYGGSSRSLHSQALSKSQIDGKPDPAII
YASAPCH
Download sequence
Identical sequences A0A074ZIE3
XP_009169503.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]