SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZP83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZP83
Domain Number 1 Region: 8-79
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.88e-16
Family CRAL/TRIO domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074ZP83
Sequence length 199
Comment (tr|A0A074ZP83|A0A074ZP83_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER27622.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_05344 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MSAINCSPRLGYECAQVLSNHYPERLGLAICIRPGPMFKVAWQAIKPFLPIQTANKVCIV
NSKSQLQPTLEQHFPKSIVQWLTEEYNLNRAEPKLSRYRPFWLHRPDTDGSHDPRGDKPY
VDNWVVKTHSSGHLPHPNMIDYLSGKLRSTANLMELNEQVDMVEDDEMAEVDEATAKKLL
ASLPSQYQIPVDAKTAATN
Download sequence
Identical sequences A0A074ZP83
XP_009168599.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]