SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZPD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZPD8
Domain Number 1 Region: 18-68,133-190
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.4e-24
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074ZPD8
Sequence length 190
Comment (tr|A0A074ZPD8|A0A074ZPD8_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER25175.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_14265 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
GLVPLSTDDQPTGCVFVFQNRTGQIASPDHPLWYSNDANCSWTIALNEGCVIQLKFDSFA
SIEVTTTLEPSQSHFNVVCGILEENPECILIKDNEMHPLNSALTMSPRLVMKRLQSNCQA
RRTDQQPNSLEEEYDWLRVYDGIDNSAVLLGEWSGTELPPILSSTSNYLHINMTSDSFVR
SPGFSANFTS
Download sequence
Identical sequences A0A074ZPD8
XP_009171100.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]