SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZTB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZTB1
Domain Number 1 Region: 14-68
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000127
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 219-232,274-315
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000195
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074ZTB1
Sequence length 669
Comment (tr|A0A074ZTB1|A0A074ZTB1_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER26615.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_13970 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
LPYSGEGAAYHKAYQWGSWSAIPITCSVTCGRGLRCRVRKCLDGYGREAPDTRRCQNPED
FMSKAEMCTVCEVRAKCPTLPNWGAWSPWSSCIPKETRDKRPEERCLEGLRVRNRLCNNP
PPEPPPYGVPCSGSANQTMECRHNCDDRPVFEPNDIVKQIQLRVEMDHRKGLQSFRQVRR
VKVGQSVRMSCATPAFKLAKKLIVTERFAPEKRGMEGSELEVRWYKNGIPLETEDDEVEA
NKIRKKPKRIAATEVHELLHEQLRWESLLPSTVPRLHDFGLEFTSIREGDQGLYTCEIHY
ARYRWMTIFYSLTVRGVRYVSQGTDPFYLHSNLGVTNALSTASVWLEAAQIVWKLNGRVR
LRGLISRPTRRIQLLEKLNRTQGGTWQCFLVIPAAGPSSRVSKPAIRVSGTYLINEFELR
VDPPQDHLWHIAQNPASIRILRNIVVTLGIMCLFLFWFLLLTIWAAKRWVGRSLTVLQKK
TVVQEILDNESRLLLTCRKRATINRERLMPFLTHEHERLTRAAAHLNERFVPSLGDEELE
SEENDKGHGTIGSMFGRGISRVSTMLRGVGSIRLFGSQKGSIYKRRESQKSTGELSMTNR
VEILKGLFGGQADGEQATRNSVGEVKKANIKNMFSLMGAQKRPVRRGTAMVPTFKMGEED
HDTMVTAGK
Download sequence
Identical sequences A0A074ZTB1
XP_009169664.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]