SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZU02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZU02
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.6e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0082
Further Details:      
 
Domain Number 2 Region: 193-226
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000668
Family B-box zinc-binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074ZU02
Sequence length 261
Comment (tr|A0A074ZU02|A0A074ZU02_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER26875.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_05933 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MPCFQCGRKFGFAAKEVACRSCNRIFCSKCVKYKVVLPEHGNKQCEVCFSCYDKATNPDQ
PVAPKLEPPKILLDRMEALGISSSGVPSSVPGACGGGGCAVRNRSHSPAVPHIGELELRL
DALRDVPKPDEVPSHEELQERLRKLRESDHVQQNISNPVKSDKVSNLIDQVHAERNIDGG
ATVNLDGSDEGELPWCCICNKNAQVCCVDCDGDLFCKACYRTFPPSVRSRNCYLCIVRRS
HRSGEEKHHQWEPFAPSRRVQ
Download sequence
Identical sequences A0A074ZU02
XP_009169344.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]