SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074ZW91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074ZW91
Domain Number 1 Region: 415-456
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 266-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000119
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074ZW91
Sequence length 587
Comment (tr|A0A074ZW91|A0A074ZW91_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER31401.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_02316 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MPGSRVARYEPFLNHSEELAIPLAVTSKDMTRQPRLQLILTVIQLSYMLGYMEGTDTRIK
IVYPSHWHQSRTAFGFPFHFKAFYMPVLADWKTSAPTLKSWQYLSTAHYEIPRYVKEGYW
IPQAFKSYCTKEAASKSYAETIHAFTHEDFSKDTQDSIRQHFTLSGKYYDQGYFTVLYYL
LNICQCLRNRLTDLHCPNPCWRPNACSSVQHSTGVCHVVSDPTLRLQIHHRLRSSLRGIY
DLDHRCDCDRNYVFNRTENKCIQMKTECSPNDCYNGGLCESLPVNRRGIGGMTYVCHCPP
AWQGPLCEEVRNPCKLSHFLCEPYQCVRDVNNRFKGYACTCPPGTRSMSHTNPRCVNINE
CKELTSPCLNGGICVDREPPAANAPVKEGEPYGYACLCRFGYTGARCERPPPRLHWSGWS
RWSKCSASCGLGYHTRYRTCPLPNRCDGRRTETGRCLGAVTYCSDVVGDSALIPYGLGTQ
TVQSWDIGWTASEDRNLDDAFFWSETEDGWPSLYYVTEGFQVADILTWTKLSQLSRQWSI
TQLMIFHAVVLGLVTVPILLIFLAISRTLQSFVRRHKKSSQEGSEDK
Download sequence
Identical sequences A0A074ZW91
XP_009164794.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]