SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075A1L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075A1L1
Domain Number 1 Region: 3225-3314
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-25
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 1479-1573
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 1967-2068
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-19
Family I set domains 0.008
Further Details:      
 
Domain Number 4 Region: 2077-2161
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 2356-2465
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-18
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 6 Region: 735-830
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 2563-2660
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 1581-1674
Classification Level Classification E-value
Superfamily Immunoglobulin 2.64e-18
Family I set domains 0.057
Further Details:      
 
Domain Number 9 Region: 1681-1789
Classification Level Classification E-value
Superfamily Immunoglobulin 4.26e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 10 Region: 1878-1978
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 923-1017
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 12 Region: 833-927
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-17
Family I set domains 0.045
Further Details:      
 
Domain Number 13 Region: 2258-2359
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 14 Region: 3136-3229
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 15 Region: 2749-2844
Classification Level Classification E-value
Superfamily Immunoglobulin 1.9e-16
Family I set domains 0.034
Further Details:      
 
Domain Number 16 Region: 3546-3597
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.45e-16
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 17 Region: 2458-2564
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000108
Family I set domains 0.0065
Further Details:      
 
Domain Number 18 Region: 2937-3030
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000126
Family I set domains 0.019
Further Details:      
 
Domain Number 19 Region: 2654-2751
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000141
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 2838-2936
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000344
Family I set domains 0.0087
Further Details:      
 
Domain Number 21 Region: 3316-3366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000693
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 22 Region: 1124-1228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000086
Family I set domains 0.037
Further Details:      
 
Domain Number 23 Region: 2172-2264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000977
Family I set domains 0.021
Further Details:      
 
Domain Number 24 Region: 1040-1118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000117
Family I set domains 0.0093
Further Details:      
 
Domain Number 25 Region: 3427-3486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 26 Region: 3372-3422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000772
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 27 Region: 3485-3544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000811
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 28 Region: 3020-3113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000142
Family I set domains 0.0071
Further Details:      
 
Domain Number 29 Region: 1369-1482
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000667
Family I set domains 0.018
Further Details:      
 
Domain Number 30 Region: 589-691
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000593
Family C1 set domains (antibody constant domain-like) 0.07
Further Details:      
 
Domain Number 31 Region: 76-254
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000222
Family Integrin A (or I) domain 0.042
Further Details:      
 
Domain Number 32 Region: 3975-4033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000146
Family EGF-type module 0.012
Further Details:      
 
Domain Number 33 Region: 4203-4259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000024
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 34 Region: 1787-1871
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000881
Family I set domains 0.01
Further Details:      
 
Domain Number 35 Region: 490-567
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000402
Family C1 set domains (antibody constant domain-like) 0.03
Further Details:      
 
Domain Number 36 Region: 4051-4178
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000879
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 37 Region: 1201-1289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000155
Family C1 set domains (antibody constant domain-like) 0.06
Further Details:      
 
Domain Number 38 Region: 3704-3928
Classification Level Classification E-value
Superfamily GFP-like 0.00000157
Family Domain G2 of nidogen-1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075A1L1
Sequence length 4468
Comment (tr|A0A075A1L1|A0A075A1L1_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER33226.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_00915 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MARQSQPHPKIRLRLLHLYSLASTLLLLCTTNAEEARSSYRSTIDEIPVYESISMELPDV
NISYALTDDPTTTSAISLAIVFDSTGSMGNDLKQVKIGARRILQRHMQRGEANYIKDFVL
VKVHDPDVGPARVTTSTKTFYQYLDSVYTQGGGDCPEMTITGIELALEASRPNSLIYVFT
DSSAKDYNRTDNVLSLIQQKQSQVVFVLTGFCDTMDEPGFEAYRQIATVSSGQLYIIGKG
QVDEFMQVVEAAVEARKVHILQQDTYSEQAKIYSFPVDSHLSQLTVQVANHKRGQAIDVR
IRNPQRKLIGPEDGLKRLMKAVSSVFVGSLDRPTPGEWTLEVITKPDESAGKEASIGEMD
LEDEEQWFSVRVSGISDVDFLQGFSTTPKEYNQAGSQQPIAGVKNFVMVNMTGRFQPGRL
DHLDMRAPNGTSLVRLPMKQTGTSHVFVSQHAMDPLSEHAYLQASVSGRDGQGFPFQRYS
KVALSGRKPRPIVITCPPKIELQRGATTELACTVNSEVPYTIKWYKDGRHLAGHADENKI
YNQPGSVLYTITDANEDSHGIYAAEVHPTITEGDPKIDGEFKDEVAVVILPPPPRVLIPR
NTSVEPGVATLTCTIFSLDESVKVRWYRGLETPFELRDGRRYRIETTQEASPGMPAQALT
SKLTINGATKSDAGKYICQAEHRGGTSDAEGFLHIHGLYKSANQRLLTYCQVITKSRPQY
NTLGKLNDVDGDAVTPKIRLDTDSVTFKEGSALILSCLSEGTPQPKIVWLFNKAPLSVKE
PESPRVTFQEDFMESRLIIQPAKEEDAGVYTCLAVNSAGNDSRTITADFIASPTVDKIEL
STSSPVEGQPLTITCHVSGKPKPRVRWDFNGSPVTPNSKIRIDEEEGKLELLSAEQRMRG
EWTCLVENSAGTARKSVTVDIGYPPKFRLDMVPGKILAEFSMDTILACPVEGHPMPMVKW
YRVTPSGNLPVQYGDRYRLQADNSLSIRDVNMEDAGAFVCEAVNMYGKDSHTVLVDIGGT
KAPMISFTDPKQTAISGAPEKRLVCNVLDAKPVATVMWLKDNQPIDVGASSKYTLDNHDL
IIRDLNDKDEGIYTCIARNVIGKAKFDIELDVQSKPAFVDPRKSQRIDVTQGDNLVLECL
VTGDPRPVVEWRKDGRRILPHGPTPGSDRNFGSSNGAGPTVVVSPDGYKLTIYSMTDAMA
GSFTCSAGNIHSMETKEFDVSVKTPPSISKEGPSEFELGQQEVGLLTCFVGVSQPPALVQ
WYKDGHPLSPIPGRISFLDNGYTVAQRTTELPTSLNSKSVWKNRITTATGSFYQHPCRFP
VRRSEDKTIWIPDPTNAECRAENEAGHDSRFFQVTVLGMAIDRLVSHSHLSTLVPPTITT
GDSYRRLLVQSGDRVEIQCGMQGYPEPKLTWHWNGQPLSTKGTIQEGMASNLGIQLVPKG
PEQTDIVIMEMTPELQGNYTCLGTNKGGSTELVYEIVVLEKPFIDGFNEKAVVFVNNTIT
LTCEAGGSPPPRVTWYFNGQPLNPDKQSGYRLVGPKNLMLLSARPHQGGDYTCVAENEAG
SARATTVLTVFEPTDSQQLQQNLTVKTTRMGGNITFTCIMSSNPPAQIKWLKDEKDIFSV
MPQDRFTVSPDGSTLTLFNVNLEDQGEFKCVAVNIPGSWNYRYTLEVTSSPGILKHSSSA
QFVNVNEGTELRLQCLATANPEPVYQWLKDDTPLTMHVLALGNEVVDSSTVRTNTSGISS
RYSIHDNGRLLLVRDIQTHEAGRYTCVASNIVGEDRLEITVSVSAAPSITDGKDHETPIF
ERGKPSHLWCNVSGNPEPTIRWEYDLPTSGPGDRNIQERYDGRQLYLPNVDYGLITRYAC
VAKNKAGEVRKIFDPTLVYAPVITGPEGKNPRPVLQDASTRLFCDWDASPRAQVEWFKDG
ELIDPKRFSRANISSSETQLYLYNVQPTDAGKYRCVVSNEYGQAKRQWTVQVMSPPTIRF
STPEGEQSVSLGSALALFCVASGHPPPKITWTRDGKPIDLSRYSISEDQIHLRLPEVAEH
DSGRYACLVSSEYGQTSKTFDVKVTYAPRLDSDGQLQYSLERTVGGSALLECLVSGNPVP
KITWYKDGVPLDQLPYRYRLINQDRQLEIIAMQPSDAGRYRCVARNPFGQIEINTDVVVG
APARVDRGRVRTDYTIREGDELVLPCPANGSPPPRIQFSKVGDSGSGWNENTMPRHAVVS
QDRQTLAFFRTRKSDSGTYQCNASNAVGWDIMEYIVRVRVPPTFDTSNVQPEVHWFVNQT
RSLDCTLMEGIDPAPQIKWERRGVPVVSGPDIQISADGSKLTVPQVQPRDGGEYICHAQN
EVGKSTQIFNVLVYVRPKFVDATRRIHVQAVQNETIQLQCEATGEPRPRFSWFKRDVEIL
RPKVIGSPFGGSERSNIAILSGDQILQISNIQLKDKGEYTCTASNGGGTIEKKFNVSVIV
PPMIIKRGVSPEEHRTKEYVPITFYCLLRNINQTDPEITWTKDGAPVLMSGDSDYFVIHD
QGQSLTVVRPTVAEDGTYRCIAKNRAGEDSHSFQLSVIAAPRFPPDFVRFREKLVARLGQ
EVELPCPVLGSPAPIVTWYLNGAPLNLFTAPVKYVFEEDQRILRIPAASNKDPGEYQCMA
RNEAGNVTKVYELDVIMPPLVRLDKTEVREREGATFTVQCSAEGHPQPTLEWSREVGGLF
RLGTSVDITTGVLTITDAKKEDAGRYICTATSKVGQDTKSVVVEIIERPTIHTSLEPILV
KENAQVLLPCQATGTQPIRIQWLLPSGQLITADQPGVFRQLPDQGLLIEKVRPEHAGRYR
CSANNEAGFQNAVISLEVLVPPKLRRPASLELSGRLNSVLQLHCEVESGSPTPIITWERD
GLTFSRTRSYYTTTESGLFIFNSLKQEDEGELTCVAKNPAGEDRLTYRVFVQIPPRVSMP
VSTIGYEEQSVTINCEVEGQPEPEVSWEFRGQPLSSYLANRVRFETPTQVTIYNLQPSDG
GSYFCIARSTGQDVAMDSTYLTVFTKPTFERTPNKTTEAYESRWIQFRCVANGHPKPDIR
WTHKNDPIPSNPSKNGIGSLVLGPLRTEQPGMYACLAKNEAGVVEYPFELRVKRFLITNA
LADFILIPSSACVARPRVHVYQSDEPIKVSEPTRLHCDVSGDVDSVVWLKDGDVVSNSSR
ISIVDHGKSLVIRMTKARDTGTYQCIATNPVGEDLGELHLVVESKPQFITVPRNMTVQMG
ALVTLECKAEGEPQPTITWYKDGQLLELGGTRSLVNNGSLRIVGVSNDDEGNYYCVASSS
LGEDFSSPATLQVQLDGNWAAWSAWSACSHTCGHGSQTRSRTCSDPEPKNGGAYCPGENT
EARTCLVSFCPVDGAWGAWTPWSACSATCGAGLSQRQRRCDNPPPSNGGKTCAGEAVEDV
MCQGLPPCPISGSWSPWSPWSECSAACGTGGTQSRERTCDNPPPTNGGRQCPGKGLMVRA
CNRGPCPVNGAWGNWGPWSHCSRSCGGGQRTRTRRCDNPTPAFGGEECPATGYMEVSECQ
NNACPINGEWSNWSSWSACSRTCGVGLQTRERECTQPAPQFGGRLCPGSAKEVRTCEVNR
PGSSIACPGTDQVTHQASWSEWSAWSVCERDCLFSGPRSELGGWQRRSRSCRLTSNEGEA
DKNNGQQTHGCPGPAEDVQQCTPELGSLECADSTDRPRSGVIFGHLRGQINKVDIGVIPI
NASWSMPEGRGPTNYHFELSEVPPEHSTCLQAMSELYGPVFWYAAQEVSGASNGNSVGIN
GGTINWESLGQFSDGSQIKISTRLTPTNEGSQQTADKSQRFLRMDSYVTGSCSVSLSESA
RKGEDLVIKLHPFKENIVQLNPHKGELHAYSSRAFGVQKPGDLRSRIEPNAWTSAIQTTG
GRRQRYLNQELNVERTNMNADKPKRIIQLWAEAYITKPPTGGFCPAGFELQQTRFSGIGS
ALEAQRDYCQDVDECSSRSLNQCDHICENTIPHYKCACHSGYRLSSDGHSCVDIDECVAN
PCTDEQKCVNTPGGYECKKSCAVGLREVADGCQDIDECTEKPTVCGIHQCVNTYGAYYCA
CLPGYVETEDGCRDIDECIDSAANQCRENERCVNLPGTYKCHLACPIGYRVLAKPNSNTI
ECIDLDECALGTFNCPPGSRCWNEPGSYACRCANGATAGARGCDYRNETLCNEGFQWDEV
KGCVDVNECQTNSGQGPCQYKCINTFGGFYCECPPGYKLDKQSNTCKDVDECSFKPSVCR
FDEFCLNVPGNYTCVQKKCQKDYIFDHRSRSCRIRCTDSKLPCPHGAKYADTIDYLIVSF
PTPIHGRATGSRVKLRVVDWNQIQQSNCLYRLLEKAPNTPVNYRADDGVVYLTPVWNTMA
EDSFLTAELRAASNETQVTYGGQQHPSGDLFYLFFRVSCYRYPLPVDELKRIDWGEPSTA
QTQWQLKQNVLVFQHSFYVYISIAKYPF
Download sequence
Identical sequences A0A075A1L1
XP_009163074.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]