SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075A7Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075A7Z7
Domain Number 1 Region: 452-571
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.28e-31
Family Regulator of G-protein signaling, RGS 0.00025
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-16
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075A7Z7
Sequence length 714
Comment (tr|A0A075A7Z7|A0A075A7Z7_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER31810.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_12912 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MLKTRRLLLHKNSSGYGFELGSELPYVVSRVKPHSLAELKHIRCGDILLSVNGIDVSRLS
HQQLLSLIESSSSPIELEFLPIHDELQVPGCAELSSRSVIEIPNPCTSGGMVLPEDKLAA
IVQYVGKLSIAHQIVISQTNLTRKLLPLKQKADQKQIEGIKLTNIALFEAIYDRLLIRFT
SKILRYSGSDLIDATVLDDDRRFFYMIMRAPDFRCPADGGSGGTSFSCFLFRCLPPSLLG
HRSHTDIVNQFQLTCHRDRLTGVCAEFPRNAETVVRILRHIIDLPMKGFANLMETPANQC
RSKFVAMQAASTCGFRQRNTRLIAGRDSFSDVGVTTPQLPVVTPTFKRPATVSRTSASHI
LHKLSRAACRLRERWFDRRGSVVQEASPYAARTSRLVHRASLPSPTSQKQLRTSFLHSAS
LDGLQEYTEDHEMASVASTTDLGRGNYDPPSLDFDYFLSDPAAIRSFRAFLSSEYSSEHL
DFWLSARDWRATFSNSQTCNSAAKTIFNTFIDPNSSCAVNIDQDAVKQASNQLSCPHVDM
FAQAERQVYQIMKMDPFPRFRDSQFYRDFLTSLRQQSSEGKENFSPTTDMVTTSCVPKNR
STGRVTGRLSTPNCATVISTPTCRMSLDNMITEDSTPVPRLRSACRSWSTRTKKKRKSTH
VSYGIAPTYGDKRRQSWCEHAGVSQCLLSGEVHHHHHRQHDISVQHQCFTAVQP
Download sequence
Identical sequences A0A075A7Z7
XP_009164484.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]