SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075AGZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075AGZ6
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000246
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0023
Further Details:      
 
Domain Number 2 Region: 56-136,246-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000266
Family Extended AAA-ATPase domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075AGZ6
Sequence length 303
Comment (tr|A0A075AGZ6|A0A075AGZ6_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER29219.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_04069 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MAVPFSNTKLRVPLGFPSLLEGLSREVLRHQPKDIFGFAEKYFEGLLRKREETGTEDIAQ
LTSRLYDRYYNNQAYCRLHLSSSDAEQKKAAVTIQTEYRRHHAQLQTEEVRKEVAAVQIQ
SCYRGYRTRKALKIGDSGQQTWADAGEYPRECKRADNFISDEEASPEASIQTQSEDYTLE
KSYQDQSPGTERSDYIPASLTEEPEANLTQVNTTEEASKSQVSPFTDQKNSTEMSSEVDI
NLEDPEVEKAALKIQAHYKGFKSCKKQTASDPSSEAKVQKPASLESNDLFGSGTQFLPQS
IFF
Download sequence
Identical sequences A0A075AGZ6
XP_009166979.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]