SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075AI24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075AI24
Domain Number 1 Region: 7-53
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000366
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075AI24
Sequence length 74
Comment (tr|A0A075AI24|A0A075AI24_9TREM) Uncharacterized protein {ECO:0000313|EMBL:KER30889.1} KW=Complete proteome; Reference proteome OX=6198 OS=Opisthorchis viverrini. GN=T265_02813 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Opisthorchis.
Sequence
MCINFETGSMLGQWSGRDLPPSVKSTSNRLLIAMRTDGSVAQKGFAANYDTTCRESGKPS
PVIICLYSAFSIFA
Download sequence
Identical sequences A0A075AI24
XP_009165402.1.43250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]