SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075AXB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075AXB5
Domain Number 1 Region: 126-254
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.83e-21
Family Regulator of G-protein signaling, RGS 0.00097
Further Details:      
 
Domain Number 2 Region: 12-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000375
Family DEP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075AXB5
Sequence length 268
Comment (tr|A0A075AXB5|A0A075AXB5_9FUNG) Regulator of G protein signaling superfamily domain-containing protein {ECO:0000313|EMBL:EPZ33164.1} KW=Complete proteome; Reference proteome OX=988480 OS=Rozella allomycis CSF55. GN=O9G_001133 OC=Eukaryota; Fungi; Cryptomycota; Rozella.
Sequence
MNAQFDTGLCLNVKERLHKLRNVTSTARGCDIVDWLMYNTTCVNRNQALALSEVLLQRAF
LKSLNDNAGFNDNNNDIYRLPISGLRHMFGDMIQEEGTEPLNDSADPQSIEKNREIESSQ
AVRQNSVSHSFTKKQLLLIILDDKQSLAAFSKCLQKLLCTENLDFYLKVKDFTFSAVKSK
GSPQIVSEAREIWNTFLENDELNVEDNEKRRVKQLLDSGNVDESIFDNMQKHVFFMMMTD
SMAKFLTSEEFKTIQARLTFLTTVGRKK
Download sequence
Identical sequences A0A075AXB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]