SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075B2Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075B2Q3
Domain Number 1 Region: 192-309
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000427
Family Regulator of G-protein signaling, RGS 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075B2Q3
Sequence length 320
Comment (tr|A0A075B2Q3|A0A075B2Q3_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:EPZ35246.1} KW=Complete proteome; Reference proteome OX=988480 OS=Rozella allomycis CSF55. GN=O9G_000642 OC=Eukaryota; Fungi; Cryptomycota; Rozella.
Sequence
MQDSVHNQHTNNKGNNSSKEASIIDASALNSNASKGGPRVYVIPNGVSVYIVVKITFYCS
LISTVFCVINILANTDDIYGSCPFHALIPITSHRIIVSLANLYVITELINIDDSFHIKKD
IFLSVLISIIATIMFVVVAFLPDDSPLGLLGNNLWPTVGYVTTHLYSCVIPLIKSYLHVE
TKLGVQYSKEAFERALADKATFSRLKELAIKHFEVENIMFYDDYQKLIANRPNLEEKSNR
SILHENSASSKRVHAIYSNFLVENAPYELNIPSTIIKQARELKNIEGIDLVAKEVYSMIY
LNTFRVYVKQQQGKDGAENV
Download sequence
Identical sequences A0A075B2Q3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]