SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075C5A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075C5A9
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Histone-fold 4.49e-38
Family Nucleosome core histones 0.0000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075C5A9
Sequence length 73
Comment (tr|A0A075C5A9|A0A075C5A9_9HEMI) Histone H2A {ECO:0000256|RuleBase:RU003767} OX=981288 OS=Tytthus chinensis. GN=H2A OC=Panheteroptera; Cimicomorpha; Miridae; Leucophoropterini; Tytthus.
Sequence
GLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPR
HLQLAIRNDEELN
Download sequence
Identical sequences A0A075C4X2 A0A075C4X4 A0A075C4X6 A0A075C4X8 A0A075C4Y0 A0A075C4Y2 A0A075C4Y3 A0A075C4Y8 A0A075C4Z0 A0A075C546 A0A075C548 A0A075C550 A0A075C555 A0A075C556 A0A075C561 A0A075C565 A0A075C566 A0A075C568 A0A075C571 A0A075C572 A0A075C573 A0A075C580 A0A075C585 A0A075C592 A0A075C596 A0A075C5A1 A0A075C5A5 A0A075C5A9 A0A075C6A8 A0A075C6B0 A0A075C6B1 A0A075C6B3 A0A075C6C0 A0A075C6V2 A0A075C6V3 A0A075C6V5 A0A075C6V6 A0A075C6V8 A0A075C6W0 A0A075C6W1 A0A075C6W5 A0A075C6W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]