SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075F4W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075F4W3
Domain Number 1 Region: 142-476
Classification Level Classification E-value
Superfamily gp120 core 3.63e-171
Family gp120 core 0.000000000226
Further Details:      
 
Domain Number 2 Region: 524-649
Classification Level Classification E-value
Superfamily Virus ectodomain 1.17e-57
Family Virus ectodomain 0.00000909
Further Details:      
 
Domain Number 3 Region: 84-134
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000381
Family gp120 core 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075F4W3
Sequence length 847
Comment (tr|A0A075F4W3|A0A075F4W3_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVKGIRKNWTHLWRWGTMLLGMLMICSTAGHLWVTVYYGVPVWKEATTTLFCASDAKAY
ATEKHNVWATHACVPTDPSPQEVVLENVTENFNMWNNDMVEQMHEDIISLWDQSLKPCVK
LTPLCVTLNCNNYTNKTHEEVQEMKNCSFNITSSIKDKIIKEYAMFYKVDLVSIDNGNTS
YRLISCNTSVITQACPKVSFEPIPIHYCAPAGFAIFKCNDKKFNGSGPCTNVSTVQCTHG
IRPVVSTQLLLNGSLAEKEVIVRSQNFTDNAKTIIVQLNESVVINCTRPNNNTRKSIHIG
PGKAFFAHGEIIGDIRQAHCNLNRGQWENTLKRVAIKLKEQFGNKTIIFNQSAGGDPEVV
MHSFNCGGEFFYCNSTQLFNSSFDSSWSNDTDSNETITLQCKIKQIINMWQKVGKAIYAP
PIRGQIRCSSNITGLLLTRDGGNNSTNGSETFRPGGGNMRDNWRSELYKYKVVKIEPLGL
APTKAKRRVVQREKRAVGLGALFLGFLGAAGSTMGAASVTLTVQARQLLSGIVQQQNNLL
RAIEAQQHMLQLTVWGIKQLQARVLALERYLRDQQLLGIWGCSGKIICNTAVPWNTSWSN
RSLEDIWGNMTWMQWEKEIDNYTNQIYDLLEKSQNQQEKNEQELLELDKWASLWNWFNIT
NWLWYIKIFIMIVGGLVGLRIIFAVLSIVNRVRQGYSPLSLQTPSHHQREPDRPEGIEEG
GGEQGRDRSVRLVNGFLALAWDDLRSLCLFSYHRLRDFILVAARTVELLGHSSLKGLRLG
WEGLKYLGNLLVYWSQELKISAISLLDTIAIAVAGWTDRVIEIAQRVGRAIIHIPRRIRQ
GLERALQ
Download sequence
Identical sequences A0A075F4W3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]