SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075F7P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075F7P1
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily gp120 core 6.15e-49
Family gp120 core 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075F7P1
Sequence length 103
Comment (tr|A0A075F7P1|A0A075F7P1_9HIV1) Envelope glycoprotein {ECO:0000313|EMBL:AIE58347.1} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
GSLAEEEVVIRSANFTDNAKIIIVHLNESVEINCTRPNNNTRKSIHIGPGRAFYAGDIIG
DIRKAYCTINGTKWNTTLQRVVEKLRGQFGNKTIVFNQSSGGD
Download sequence
Identical sequences A0A075F6P3 A0A075F6X6 A0A075F6Y3 A0A075F7K8 A0A075F7P1 A0A075F8V9 A0A075F8W1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]