SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075FLI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FLI1
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000759
Family Rieske iron-sulfur protein (ISP) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075FLI1
Sequence length 60
Comment (tr|A0A075FLI1|A0A075FLI1_9ARCH) Rieske (2Fe-2S) domain-containing protein (HcaC, bphF) {ECO:0000313|EMBL:AIE92123.1} OX=1455898 OS=uncultured marine thaumarchaeote AD1000_19_G10. GN=hcaC OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MHQDNPITAGKLDGDIVECPSHFWHYNIKTGELQDYLKGVKLQTYPVEERADGIYIDLQQ
Download sequence
Identical sequences A0A075FLI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]