SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075FQK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FQK6
Domain Number 1 Region: 97-180
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.73e-18
Family TATA-box binding protein (TBP), C-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 0.0000000000942
Family TATA-box binding protein (TBP), C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075FQK6
Sequence length 183
Comment (tr|A0A075FQK6|A0A075FQK6_9EURY) Transcription factor (TBP, tbp) {ECO:0000313|EMBL:AIE93579.1} OX=1457762 OS=uncultured marine group II/III euryarchaeote AD1000_39_C04. GN=tbp OC=Archaea; Euryarchaeota; environmental samples.
Sequence
MTDLKIENVIAASHLGKKVELIQLATEMPNARYSGSGDPSVIVEVDAGGNKRAAGVLFGN
GKILVTGIGSLDEGRQVMESLKKMIKTVDPKVNMKRAIKLENIVAKANLGRVFDLQSVAL
AIPGSEYEPTKFKGLVIRMNDPQSSFILFQSGVLIVTDVISEGKAKKALNQLEKFLAEIS
VDS
Download sequence
Identical sequences A0A075FQK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]