SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075FR99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FR99
Domain Number 1 Region: 9-181
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000707
Family Rieske iron-sulfur protein (ISP) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075FR99
Sequence length 200
Comment (tr|A0A075FR99|A0A075FR99_9ARCH) Rieske (2Fe-2S) domain-containing protein (UQCRFS1, RIP1, petA) {ECO:0000313|EMBL:AIE93838.1} OX=1455915 OS=uncultured marine thaumarchaeote AD1000_41_B03. GN=petA OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MSEKEEKTGGMSRRDFLKLMGAAGTSVAFAPFVPWGKFMPNPSSVTLEKVPVILPDGTQA
NLNTFPINHAEVITYPETADEVLNEEAFRKWQFIRLPEKFGGARKDVSSFRAYSMVCLHL
WCLWKYWPEEGRMRGECPCHGSMYDVQTGTSFLGPASLQAAPSNTLAELNFEVDSDGFMF
ISPPTWGVNANGVVGYGRFA
Download sequence
Identical sequences A0A075FR99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]