SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075G6B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075G6B5
Domain Number 1 Region: 7-92
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.52e-22
Family TATA-box binding protein (TBP), C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 162-236
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.4e-22
Family TATA-box binding protein (TBP), C-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075G6B5
Sequence length 238
Comment (tr|A0A075G6B5|A0A075G6B5_9EURY) TATA-box factor {ECO:0000256|HAMAP-Rule:MF_00408} OX=1457844 OS=uncultured marine group II/III euryarchaeote KM3_102_C05. GN=tbp OC=Archaea; Euryarchaeota; environmental samples.
Sequence
MLSDEERLTVVNVVASTRVAEELDLPDIAIQLNCEYEPEQFPGVVYRVKEPKLAILMFRS
GRAVCTGGKNEDNIQTGIEMMTRDLRAAGIETWDLKDVEIEVQNMVATYSLFYPEEYTGV
ARMDDNNTRVIDGSDGMRAATDEEVKEEDPRIRGIREGEPLAALPRKLNLNNLTFHLPFD
KVEYEPEQFPGLIYRLDYPKVVCLIFGSGKMVITGARHKDEILEAVQFIQDELADLLY
Download sequence
Identical sequences A0A075G6B5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]