SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075GI21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075GI21
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 1.14e-23
Family RNA polymerase subunit RPB10 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075GI21
Sequence length 78
Comment (tr|A0A075GI21|A0A075GI21_9ARCH) DNA-directed RNA polymerase subunit N {ECO:0000256|HAMAP-Rule:MF_00250} OX=1456010 OS=uncultured marine thaumarchaeote KM3_144_G01. GN=rpoN OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MLVPIRCFTCGNLIADKFEDFQHRVKSGKNSAEVLDSLEVKRYCCRRMFLTTIETIQQIV
PFYEAIYKRNVSIQSELE
Download sequence
Identical sequences A0A075GI21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]