SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075GMM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075GMM6
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 2.62e-39
Family Peptidyl-tRNA hydrolase II 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075GMM6
Sequence length 116
Comment (tr|A0A075GMM6|A0A075GMM6_9ARCH) Peptidyl-tRNA hydrolase (PTH2) {ECO:0000313|EMBL:AIF05291.1} OX=1456065 OS=uncultured marine thaumarchaeote KM3_181_G03. GN=PTH2 OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MAIKQVIVVRTDLDMGKGKIAAQVGHACVLGAEHVRKSNPEWFLVWWTGQEKIVLKVANL
KELEQVKQDAIEFDVPWSEVTDAGHTQIAPGTTTCISIGPAPEEKIDKITGDLKLL
Download sequence
Identical sequences A0A075GMM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]