SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075GY91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075GY91
Domain Number 1 Region: 84-315
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-55
Family RecA protein-like (ATPase-domain) 0.000000143
Further Details:      
 
Domain Number 2 Region: 5-67
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000115
Family DNA repair protein Rad51, N-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075GY91
Sequence length 317
Comment (tr|A0A075GY91|A0A075GY91_9EURY) DNA repair and recombination protein RadA {ECO:0000256|HAMAP-Rule:MF_00348} OX=1457970 OS=uncultured marine group II/III euryarchaeote KM3_195_B08. GN=radA OC=Archaea; Euryarchaeota; environmental samples.
Sequence
MAEKKIIIAELEDLPGIGPTTAAKLKEAGYIDPTSVAATSPHELAEAGEFGLEAAKRAIE
AAKEALDTNFETAEQVYERRKTIGRISTGSKSLDELLGGGVETQSITEAYAKFSSGKSQL
AFQLSVNVQKSIEEGGLGGNAMFIDTEGTFRPERVVQMAEAQSMNIEEVLKNIYVARAEN
SDHQILLVDKAEELIKEKNIKLIVVDSFTSQFRADYIGRGALGERQQKMNRHIHVLQKLA
DKNNLAVYITNQVMDNPAILFGDPTRPIGGHVLAHASSVRMYLRKSKDTKRIARLVDSPN
LPEGECVFKVTAKGIGD
Download sequence
Identical sequences A0A075GY91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]