SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075H1X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075H1X1
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-16
Family Cold shock DNA-binding domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 7-85
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000000000432
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075H1X1
Sequence length 190
Comment (tr|A0A075H1X1|A0A075H1X1_9EURY) DNA-directed RNA polymerase, subunit E' (RpoE1) {ECO:0000313|EMBL:AIF10181.1} OX=1456448 OS=uncultured marine group II/III euryarchaeote KM3_44_G05. GN=rpoE1 OC=Archaea; Euryarchaeota; environmental samples.
Sequence
MNGGKKMYRLEVREDTIRIPAEYIREGQSLSQHVDRLAHQAFEGRFDDDDNFIVVTYDHE
MIGRGRIIHGDGAIYQKVRFKAVLFHLETNEIVDGAVSEVLEFGAFVQIGPLEGLLHKSQ
ILEEPVNINQNEGKVTGTRSGNLLQLKDSVRARVVTLSLNPHDPRSSKIGLTCKQPGLGA
HGWLGEEKEE
Download sequence
Identical sequences A0A075H1X1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]