SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075H503 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075H503
Domain Number 1 Region: 218-404
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 1.26e-31
Family Archaeal tRNA CCA-adding enzyme 0.0013
Further Details:      
 
Domain Number 2 Region: 123-232
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.88e-26
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.00039
Further Details:      
 
Domain Number 3 Region: 15-119
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.64e-21
Family Archaeal tRNA CCA-adding enzyme catalytic domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075H503
Sequence length 415
Comment (tr|A0A075H503|A0A075H503_9ARCH) tRNA-NT {ECO:0000256|HAMAP-Rule:MF_01264} OX=1456172 OS=uncultured marine thaumarchaeote KM3_50_F11. GN=cca OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MTCDLVSEFIKKHPQVVGFELGGSYAKGTWLPEKADIDIFVKFNKKTSEKDFRNLGTEIG
FQSLKKYKPYTRHAEHPFVEAIVDGTKVNVVPCYDVNKGEWQSATDRSIYHTKFMSQNLS
GSMKEEVRILKKFFLHLGVYGAEIAKEGFSGYVSEVLISYFGSFEKTIKKISELKKGQVV
GKTMKKFDSPIVLIDPIDNNRNLGTAISIDNLGKFVLASRAFLKKPSKKFFKKPVSNRIM
KNIDKIVVVQFRFKDRSDDIIWGQIKRASNALKTQLELGEFTVLRNSSVKDEKENAALIF
LLHAKKIESSLVRVGPEISSKDHCEKFILANFKKSQLMWINEEGKIQSLQKRKYDDVILF
LKNLLKDNLKNCGIPKGLEKDFKSGVKIINASKVSNKSIKEAIASIAVTDETIFC
Download sequence
Identical sequences A0A075H503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]