SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075H753 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075H753
Domain Number 1 Region: 7-207
Classification Level Classification E-value
Superfamily Heme oxygenase-like 7.91e-34
Family PqqC-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075H753
Sequence length 211
Comment (tr|A0A075H753|A0A075H753_9ARCH) TENA/THI-4 domain-containing protein (PqqC) {ECO:0000313|EMBL:AIF10297.1} OX=1456154 OS=uncultured marine thaumarchaeote KM3_45_A02. GN=pqqC OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MNSLIHKIDRIIEERSLLNHPFYQTWSDGKLTHEALAGYSKEYYQLVKAVPIFMTQLLDS
VPESLYDELDFNQQEEFSHISLWEQFASGLGISCKELTNYDGLNKTNHAITGMHSLMSSF
VSGSTAMYTLEKEIPKISQIKLEGLAEFYGLTSEDITKYFKEHMEADIRHTASWKKIIDG
FSGHDQEIISSAERSVTCQNLLLDSCYEEYC
Download sequence
Identical sequences A0A075H587 A0A075H753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]