SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075HDU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075HDU6
Domain Number 1 Region: 221-310
Classification Level Classification E-value
Superfamily Cyclin-like 7.03e-19
Family Transcription factor IIB (TFIIB), core domain 0.0006
Further Details:      
 
Domain Number 2 Region: 121-187
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000646
Family Transcription factor IIB (TFIIB), core domain 0.0059
Further Details:      
 
Domain Number 3 Region: 5-48
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000623
Family Transcriptional factor domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075HDU6
Sequence length 319
Comment (tr|A0A075HDU6|A0A075HDU6_9ARCH) Zinc finger TFIIB-type domain-containing protein (TFIIB, GTF2B, SUA7, tfb) {ECO:0000313|EMBL:AIF14084.1} OX=1456226 OS=uncultured marine thaumarchaeote KM3_65_H02. GN=SUA7 OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
METIEIERCTVCNSSLVDDTENGEIICSGCGIVMAEHMEDHGPEAKSNSLEDKMKLARAT
GQTSYSQHDLGITTVISIGTKDFSGKKINAEMASQMHRLGKWQQRVRVSSSRDRRLSNIL
GSISEICQKSSLPKNVLETASIIYRSLDAKNIQVKGKTVVSISAAVVYMACKQCDVIRSL
DEILREVCHERDVKSKTKLASKYYRMLVLELGTVATSIITMDKYISKIANMTNTDTRVER
LSLEIAEKTKDRSIADGKAPNGIAAAYLYIASILLGQSILQRDVSSVSGVTEVTIRNRCK
EILTSFKLNIALRPSLAKK
Download sequence
Identical sequences A0A075HDU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]