SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075HM76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075HM76
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-32
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 147-228
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 7.19e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00065
Further Details:      
 
Domain Number 3 Region: 277-360
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.22e-16
Family HSP40/DnaJ peptide-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 127-151,230-285
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000628
Family HSP40/DnaJ peptide-binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075HM76
Sequence length 392
Comment (tr|A0A075HM76|A0A075HM76_9EURY) Chaperone protein DnaJ {ECO:0000256|HAMAP-Rule:MF_01152} OX=1456512 OS=uncultured marine group II/III euryarchaeote KM3_77_F08. GN=dnaJ OC=Archaea; Euryarchaeota; environmental samples.
Sequence
MGSQRPFGDGVMAKRDYYEVLEISRDASDDELKKAFRSLARKNHPDKNPDDSEAENRFKE
IQEAYAVLSNPQQRRNYDTFGHDSPGGNPFGSSGFQGVNISMDDLFSGGFDSVFSQFFGG
GGTSRRSSRGNDVLIRHSVDMNMAMLGGETELEAKLLVNCEACEGRAAASPDGVKTCGTC
SGQGQVTQNRKIGPFIQQMVTDCPDCNGSGRKITDPCKPCRGEGRVKKKQTIRFSIPAGI
SDGTRMRMGGRGEPIRGGGGSPGDLYIQVHIEDHDWYERDGSDLLMALPLGYPELLLGTS
ISLPHIDGKDITIDVPAGSIPGDTLDVKGRGFPRSRGRGRGNVTVLLKLYVPSKLSKNVK
KQIEGLRDEIGIDLDSVEDLVRKEAKSRRGTR
Download sequence
Identical sequences A0A075HM76 A0A075HU44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]