SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075HRK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075HRK2
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily ISP domain 2.1e-26
Family Rieske iron-sulfur protein (ISP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075HRK2
Sequence length 102
Comment (tr|A0A075HRK2|A0A075HRK2_9ARCH) Rieske (2Fe-2S) domain-containing protein (HcaC, bphF) {ECO:0000313|EMBL:AIF18085.1} OX=1456300 OS=uncultured marine thaumarchaeote KM3_81_E07. GN=hcaC OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MAKILVGKTTEIMSGQMKKVSVDGNEIIVVNIDGNCFAVDDTCTHAGGSLSEGKLDGSTI
TCDWHGAQFECKNGKLVKFPVQINDLKSYKVVIESDDIFVET
Download sequence
Identical sequences A0A075HRK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]