SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075I0N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075I0N2
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily MTH1598-like 0.0000000183
Family MTH1598-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075I0N2
Sequence length 57
Comment (tr|A0A075I0N2|A0A075I0N2_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AIF21429.1} OX=1456355 OS=uncultured marine thaumarchaeote SAT1000_04_F07. GN= OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MSYKYLEHSTDAFIEVKAKNLEEAFSVAGKSVVETIIDLKTFKKLKKKVSKLKAETF
Download sequence
Identical sequences A0A075I0N2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]