SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075IDM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075IDM0
Domain Number 1 Region: 148-491
Classification Level Classification E-value
Superfamily gp120 core 1.47e-171
Family gp120 core 0.000000000233
Further Details:      
 
Domain Number 2 Region: 539-664
Classification Level Classification E-value
Superfamily Virus ectodomain 6.27e-56
Family Virus ectodomain 0.00000895
Further Details:      
 
Domain Number 3 Region: 85-131
Classification Level Classification E-value
Superfamily gp120 core 0.0000000000000196
Family gp120 core 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075IDM0
Sequence length 855
Comment (tr|A0A075IDM0|A0A075IDM0_9HIV1) Glycoprotein 120 {ECO:0000256|HAMAP-Rule:MF_04083} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVKGIRKNCQNLWRWGTLLLGILMICSATEDLWVTVYYGVPVWKEATTTLFCASDAKAY
KTEVHNVWATHACVPTDPNPQEIKLVNVTENFNMWKNHMVEQMHEDIISLWEQSLKPCVK
LTPLCVTLNCTDARNNTNITSTDMEKGEIKNCTFNVTTGIQGKVHKERALLYRLDVVPLN
DSNSNNNYSSYRLISCNTSVVTQACPKVTFEPIPIHYCAPAGFAILKCNETNFTGTGPCK
NVTTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSENITDNVKTIIVQLKEAVKINCTRPN
NNTRRSIPIGQGRAWYATGDIIGDIRQAHCNISKTEWNNTLKQIVIKLREQFRNKTIVFK
PSSGGDPEIVLHSFNCGGEFFFCNTTQLFNSSWNDTSTGNSTENNTETSNELITLPCRIK
QIINMWQEVGKAMYAPPIKGQIRCSSNITGLLLTRDGGKINSTNETFRPGGGDMRDNWRS
ELYKYKIVKIEPLGVAPTRAKRRVVQREKRAVGIGAVLFGFLGAAGSTMGAASMTLTVQA
RQLMSGIVQQQQNLLRAIEAQQHLLQLTVWGIKQLQARILAIERYLKDQQLLGIWGCSGK
LICTTAVPWNTSWSNKSLKTIWENTTWQQWEKEIDNYTELIYALIEESQNQQEKNEQELL
ELDKWASLWNWFDITKWLWYIKIFIMIVGGLIGLRIVFTVLSIVNRVRQGYSPLSFQTRL
PAPRGPDRPEGIEEDGGERDKDRSGPLVDGFLALIWVDLRSLCLFIYHRLRDSLLIAARI
VKLLGRRGWEILKYWWSLLQYWSKELKNSASSLLNVIAIAVAEGTDRIIEAVRRSFRAFL
HIPRKIRQGFERALL
Download sequence
Identical sequences A0A075IDM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]