SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075IG31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075IG31
Domain Number 1 Region: 121-457
Classification Level Classification E-value
Superfamily gp120 core 2.65e-176
Family gp120 core 0.000000000224
Further Details:      
 
Domain Number 2 Region: 505-630
Classification Level Classification E-value
Superfamily Virus ectodomain 1.51e-57
Family Virus ectodomain 0.00000791
Further Details:      
 
Domain Number 3 Region: 55-103
Classification Level Classification E-value
Superfamily gp120 core 0.0000000000000204
Family gp120 core 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075IG31
Sequence length 820
Comment (tr|A0A075IG31|A0A075IG31_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
VENLWVTVYYGVPVWKEANTTLFCASDARAYDTEMHNIWATHACVPTDPNPQEVVLGNVT
ENFDVWKNNMVDQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDYKTNNTNNNQSSEIEKG
ELKNCSFNITTSIKDRMQRAYATFYKLDVVPIDDNNSSNTSYRLISCNTSVITQACPKAS
FEPIPIHYCAPAGFAILKCNDKEFKGKGPCTNVSTVQCTHGIKPVVSTQLLLNGSLAEEK
VIIRSENFTNNAKTIIVQLNSSVQINCTRPNNNTRKSIHIGPGRAFYATGEIIGDIRQAH
CNLSRELWNTTLAHIATKLSKEFNKTKIIFNQSSGGDLEIVTHSFNCGGEFFYCNTTQLF
NSTWTNGTLNGTDMSNETITLPCRIKQIINMWQEVGKAMYAPPIKGQIRCSSNITGLLLT
RDGGNESGTSEIFRPGGGDMRDNWRSELYKYKVVKIEPLGIAPTKAKRRVVQREKRAVGI
GAVFLGFLGAAGSTMGAASVTLTVQARLLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQ
LQARILAVERYLRDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEDIWHNMTWMQWEKEI
DNYTSLIYTLLENSQNQQEKNEQELLELDKWASLWNWFDITNWLWYIKIFIMIVGGLVGL
RIFFTVLSIVNRVRQGYSPLSFQTHLPAPRGPDRPDGTEEEGGERDRDRSGRLVTGLLAL
IWVDLRSLCLFSYHRLRDLLLIATRIVELLGRRGWEILKYWWNLLQYWIQELKNSAVSLL
NAATIVVAEGTDRVIETLQRIGRAIIHIPRRIRQGFERAL
Download sequence
Identical sequences A0A075IG31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]