SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075ILQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075ILQ3
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.00000000262
Family FAD-dependent thiol oxidase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075ILQ3
Sequence length 95
Comment (tr|A0A075ILQ3|A0A075ILQ3_9POXV) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome OX=1651168 OS=Ectromelia virus Naval. GN= OC=Orthopoxvirus.
Sequence
MNPKHWGRAVWTIIFIVLSQAGLDGNIEACKRKLYTIVSTLPCPACRRHATIAIEDNNVM
SSDDLNYIYYFFIRLFNNLASDPKYAIDVTKVNPL
Download sequence
Identical sequences A0A075ILQ3 A0A2I2MD80 B9U1E1 G0XWE7 I0AZC4 M9WKV4 P23373 Q76RE2 Q77TM1 Q77ZD1 V5QZB3
B9U1E1_9POXV Q76RE2_9POXV Q76ZV5_VACCW Q77TM1_VACCT Q77ZD1_9POXV VE10_VACCW gi|22164655|ref|NP_671568.1| gi|66275863|ref|YP_232948.1| NP_671568.1.101981 YP_232948.1.80185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]