SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075INH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A075INH9
Domain Number - Region: 275-379
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00131
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075INH9
Sequence length 737
Comment (tr|A0A075INH9|A0A075INH9_9POXV) EVN059 {ECO:0000313|EMBL:AIF30125.1} KW=Complete proteome OX=1651168 OS=Ectromelia virus Naval. GN= OC=Orthopoxvirus.
Sequence
MISVTDIRRAFLDNECHTITKAFGYLHEDKAIALIKVGFHPTYLPKVLYNNVVEFVPEKL
YLFKPRTVSPLDLISTITKLKNVDKFASHINYHKNSILITGDKSLIAKCMPYMIISDDDI
RFIREQFVGTNSIEYILSFINKESIYRMSYQFSENEIVAIINRDHFMYEPIYEHQVLDSD
FLKTMLDRYGIVTINSGIIDELCPEAIIEILMAVVRPRDAIRFLDIVNKNQLMENSVKNY
IINDIRRGKIDYYIPYAEDFLEDRTEDLGIYANIFFEDAIDITKLEITKTELEHISKYMN
YYTTYIDHIVNIILQNNYIDILASIIDYVQDVLTEELCIRIVCESTNPVPVTSLPIHSTL
VMVMCIQMKYVDIVEFLDDIDIDTLIEKGADPITEYTFTTRWYNKHNELITLYIKKYGFC
PMMMKRLMFEYPLTKEASDHLLKTMDENRGAIMFFPRTICTLPYLLCCNYKLIQKPIPFK
EENRNIIYKKNNRVLCFDSLENSAFKSLIKIDSIPGLKTYNMKDITYEKSNNKICVRFIP
QELIHNEERRIKLQLFDIARLASYGLYYIPSRYLSSWTPVVNMIEGREYTNPQKIECLVI
LDLFSEEFIEYQNLGNVVSNKYELEYTISNYQAAINCLMSTLLIYLVLGSIRSISRTEDF
VLSILTIFYKGLKINELLSEPVSGVCIELDKIKDRVSSGDSSFIFLKKNELSKTLSLCEK
VCVETILDNNQSFKSSK
Download sequence
Identical sequences A0A075INH9 I0AZB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]