SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075IZQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075IZQ8
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0000000000068
Family Neurotransmitter-gated ion-channel transmembrane pore 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075IZQ8
Sequence length 45
Comment (tr|A0A075IZQ8|A0A075IZQ8_MELGA) GABA receptor subunit rho-1 protein {ECO:0000313|EMBL:AIF34874.1} OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=GABRR1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RVSYIKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLRD
Download sequence
Identical sequences A0A075IZQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]