SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075JGQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A075JGQ8
Domain Number - Region: 37-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0231
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075JGQ8
Sequence length 195
Comment (tr|A0A075JGQ8|A0A075JGQ8_9MICO) Uncharacterized protein {ECO:0000313|EMBL:AIF40472.1} KW=Complete proteome; Reference proteome OX=1274 OS=Dermacoccus nishinomiyaensis. GN=HX89_05415 OC=Bacteria; Actinobacteria; Micrococcales; Dermacoccaceae; Dermacoccus.
Sequence
MNATPRGAAAIEPFVARFAPSDVTPVGPAFVEYAADRLPQSLLALYRDHGIGWYGKQELQ
LVDPAVWTPVLQEWFGVGVASIPFAVTSFGHVYHLDEDGRVQCLDPHFLTNLVVAESADE
FFAEHLVGPSSHLADLRGPHQGARTKLGLLGEGELYSFTPMLPLGGTVSPDALTKGDGVQ
HALLTHRMVREQRQR
Download sequence
Identical sequences A0A075JGQ8 E3B8A4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]