SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075JTU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075JTU0
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000183
Family BAS1536-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075JTU0
Sequence length 52
Comment (tr|A0A075JTU0|A0A075JTU0_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AIF45010.1} KW=Complete proteome; Reference proteome OX=403957 OS=Virgibacillus sp. SK37. GN=X953_19575 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Virgibacillus.
Sequence
MLPSKEEIELKIEHVRYKMYQAYKKDQNYEDILILSEKLDDLLNQLDKMNHS
Download sequence
Identical sequences A0A075JTU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]