SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075MP29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075MP29
Domain Number 1 Region: 39-140
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000589
Family Pseudo ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075MP29
Sequence length 603
Comment (tr|A0A075MP29|A0A075MP29_9PROT) Ankyrin repeat-containing protein {ECO:0000313|EMBL:AIF81054.1} KW=Complete proteome; Reference proteome OX=86106 OS=endosymbiont of Acanthamoeba sp. UWC8. GN=I862_02455 OC=Holosporaceae.
Sequence
MDALKNYKNISREQLFIAALEGGFTQEANEYLNKFDVVSIYDVVDGNYLNIMKFLIKGNV
EFGKNAGIITVASGSGHLEMIKLLLEHGAKIGDDAIVNAIYGRHLDIVKFLVECGVQVRN
HDLSTVIKVGDKKLIKYILEIFPEPQATITIDENNLFILSGEIELLKMLLKIVKIPTENL
NKIYNNAIVTGNYDFAAQLHYGLDVCFETNIHSDISNAIIKGLDNSIENNKYHAIANIID
KAGIKIPRQHKHLVNNINDDIDSKEFDFIYGLTHKLAQHYINLAKVKLENNLLSQTVNEN
KINQAKKILNEIFNEDSQARLEGFQELKCIFPDDMELSKIVNEFDAYHMVVGNALNRLDN
DFTLEVLALNGVSVPVFEEDITVYRGFVADLDDGSVDILFKYGTRAFGKTKMQKTLGFHI
DESWNQLKVEKAYLWPYGGTYVSVEPFMASVFALGFTSKVKGENILLEIKLQAGAPKICG
CYPREYELVPNNVEGSEIIAVYKLNNKKMIKSVYKNPYLQDASLTPRYVVGDIIEKDKEA
IQKYNSLDCKRIEYEGYNDFLTKYSYSEEMLKPFFEGRPVYEEVVAAEKSEPEFECDLTL
QCC
Download sequence
Identical sequences A0A075MP29
WP_038538571.1.72648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]