SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075Q5L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075Q5L5
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily gp120 core 8.5e-105
Family gp120 core 0.0000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075Q5L5
Sequence length 192
Comment (tr|A0A075Q5L5|A0A075Q5L5_9HIV1) Envelope glycoprotein {ECO:0000313|EMBL:AIG14220.1} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
EEEVMIRSENFTNNAKTIIVQLNESVIINCTRPNNNTRKSIHIGPGRAFYATGNIIGDIR
QAHCNISRAKWNHTLQQIKTKLREQFNNKTISFNQSSGGDPEIVMHSFNCGGEFFYCNTT
ELFNNKTLNDTNGNITLPCRIRQIINMWQEVGKAMYAPPIQGLIRCSSNITGLLLTRDGG
NNGTHEEVFRPG
Download sequence
Identical sequences A0A075Q5L5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]