SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075Q5M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075Q5M4
Domain Number 1 Region: 113-208
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.53e-35
Family Neurotrophin 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075Q5M4
Sequence length 210
Comment (tr|A0A075Q5M4|A0A075Q5M4_9SAUR) Brain-derived neurotrophic factor {ECO:0000256|RuleBase:RU364086} OX=142480 OS=Sternotherus odoratus. GN= OC=Chelydroidea; Kinosternidae; Sternotherus.
Sequence
SCMKAAPMKEASVRGLGSLAYPGLRTHGTLESGPNTGSRDLTSLADTFEHVIEELLDEEQ
DVQPSEENKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRG
ELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYFYETKCNPKGYTKEGC
RGIDKRHWNSQCRTTQSYVRALTMDNKKRV
Download sequence
Identical sequences A0A075Q5M4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]