SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075Q9K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075Q9K6
Domain Number 1 Region: 127-285
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 7.06e-78
Family Retrovirus capsid protein, N-terminal core domain 0.0000000666
Further Details:      
 
Domain Number 2 Region: 2-132
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 8.63e-59
Family Immunodeficiency virus matrix proteins 0.00000261
Further Details:      
 
Domain Number 3 Region: 276-358
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.33e-33
Family Retrovirus capsid protein C-terminal domain 0.000016
Further Details:      
 
Domain Number 4 Region: 374-425
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 1.15e-17
Family Retrovirus zinc finger-like domains 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075Q9K6
Sequence length 487
Comment (tr|A0A075Q9K6|A0A075Q9K6_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASILRGGKLDTWEKIRLRPGGKKHYMIKHIVWASRELERXALNXGLLETADGCKQI
XKQLHPALXTGTEELTSLYNTVATLYCVHAGLPVRDTKEALDKIEEEQNKXQQKAQQAKA
DGKVSQNYPIVQNLQGQMVHQALSPRTLNAWVKVIEEKAFSPEVIPMFTALSEGATPQDL
NTMLNTVGGHQAAMQILKDTINEEAAEWDRTHPVHAGPVAPGQMREPRGSDIAGTTSNLQ
EQIAWMTXNPPTPVGEIYKRWIXLGLNKIVRMYSPVSILDIKQGPKEPFRDYVDRFFKTL
RAEQATQDVKNWMTDTLLVQNANPDCKTILRALGPGASIEEMMTACQGVGGPSHKARVLA
EAMSQVNNGNXMMQRSNFKGPKRIVKCFNCGKEGHIARNCRAPRKKGCWKCGREGHQMKD
CTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPAESFRFEXTXQEXXDREPLTSLKSLF
GNDPLSQ
Download sequence
Identical sequences A0A075Q9K6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]