SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075QC52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075QC52
Domain Number 1 Region: 98-141
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000327
Family MATH domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075QC52
Sequence length 141
Comment (tr|A0A075QC52|A0A075QC52_EMYMA) TRAF6 {ECO:0000313|EMBL:AIG13496.1} OX=335395 OS=Emys marmorata (Western pond turtle) (Clemmys marmorata). GN= OC=Emydidae; Emys.
Sequence
QTLRSISVTTTTPMSYLSGLSFEPSLFSHVPPATYDCNPEVENFKETIQQLEGRLVRQDH
QIRELIAKMETQSAHVGDLKRTIQNLEEKIAEMEAQQCNGIYIWKIENFSTHLRAQEEER
PVVIHSPGFYTGKPGYKLCLR
Download sequence
Identical sequences A0A075Q571 A0A075QC52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]