SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075QCX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075QCX8
Domain Number 1 Region: 126-284
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.14e-78
Family Retrovirus capsid protein, N-terminal core domain 0.0000000733
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 7.06e-62
Family Immunodeficiency virus matrix proteins 0.00000193
Further Details:      
 
Domain Number 3 Region: 275-357
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.12e-32
Family Retrovirus capsid protein C-terminal domain 0.0000152
Further Details:      
 
Domain Number 4 Region: 372-423
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 1.63e-17
Family Retrovirus zinc finger-like domains 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075QCX8
Sequence length 479
Comment (tr|A0A075QCX8|A0A075QCX8_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLRGEKLDKWERIRLRPGGKKKYMLKHLIWASRELENFALNPSLLETADGCKQI
IKQLHPALQTGTEELKSLYNTVSTLYCVHKGIEVRDTKEALDKIEEEQHKSQQKAQQAAD
GKVSQNYPIIQNPQGQMIHQPLTPRTLNAWVKVIEEKAFSPEVIPMFTALSEGATPSDLN
TMLNTVGGHQAAMQMLKDTINEEAAEWDRTHPVHAGPVAPGQMREPRGSDIAGTTSTLQE
QIAWMTSNPPXPVGEIYKRWIILGLNKIVRMYSPVSILDIRQGPKEPFRDYVDRFFKTLR
AEQATQXVKNWMTXTLLVQNANPDCKTILRALGPGATLEEMMTACQGVGGPSHKARVLAE
AMSQANSNVMMQRSNFKGPRKIVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCN
ERQANFLGKIWPSHKGRPGNFLQNRPEPPAPPAESFKFEKDGEPLTSLKSLFGNDPLSQ
Download sequence
Identical sequences A0A075QCX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]